DCLRE1A,hSNM1
  • DCLRE1A,hSNM1

Anti-DCLRE1A Antibody 25ul

Ref: AN-HPA036907-25ul
Anti-DCLRE1A

Información del producto

Polyclonal Antibody against Human DCLRE1A, Gene description: DNA cross-link repair 1A, Alternative Gene Names: hSNM1, KIAA0086, PSO2, SNM1, Validated applications: ICC, IHC, Uniprot ID: Q6PJP8, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name DCLRE1A
Gene Description DNA cross-link repair 1A
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC, IHC
Sequence TTPGKLCRTQKSQHVSPKIRPVYDGYCPNCQMPFSSLIGQTPRWHVFECLDSPPRSETECPDGLLCTSTIPFHYKRYTHFLLAQSRAG
Immunogen TTPGKLCRTQKSQHVSPKIRPVYDGYCPNCQMPFSSLIGQTPRWHVFECLDSPPRSETECPDGLLCTSTIPFHYKRYTHFLLAQSRAG
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names hSNM1, KIAA0086, PSO2, SNM1
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q6PJP8
HTS Code 3002150000
Gene ID 9937
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-DCLRE1A Antibody 25ul

Anti-DCLRE1A Antibody 25ul