VPS8,FLJ32099
  • VPS8,FLJ32099

Anti-VPS8 Antibody 25ul

Ref: AN-HPA036871-25ul
Anti-VPS8

Información del producto

Polyclonal Antibody against Human VPS8, Gene description: vacuolar protein sorting 8 homolog (S. cerevisiae), Alternative Gene Names: FLJ32099, KIAA0804, Validated applications: IHC, Uniprot ID: Q8N3P4, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name VPS8
Gene Description vacuolar protein sorting 8 homolog (S. cerevisiae)
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC
Sequence EEIYPYIRTLLHFDTREFLNVLALTFEDFKNDKQAVEYQQRIVDILLKVMVENSDFTPSQVGCLFTFLARQLA
Immunogen EEIYPYIRTLLHFDTREFLNVLALTFEDFKNDKQAVEYQQRIVDILLKVMVENSDFTPSQVGCLFTFLARQLA
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names FLJ32099, KIAA0804
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q8N3P4
HTS Code 3002150000
Gene ID 23355
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-VPS8 Antibody 25ul

Anti-VPS8 Antibody 25ul