VWA5B2,DKFZp761K032
  • VWA5B2,DKFZp761K032

Anti-VWA5B2 Antibody 100ul

Ref: AN-HPA036823-100ul
Anti-VWA5B2

Información del producto

Polyclonal Antibody against Human VWA5B2, Gene description: von Willebrand factor A domain containing 5B2, Alternative Gene Names: DKFZp761K032, LOC90113, Validated applications: ICC, IHC, Uniprot ID: Q8N398, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name VWA5B2
Gene Description von Willebrand factor A domain containing 5B2
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC, IHC
Sequence PRKPSLGAILDGPSPEPGQQLGQGLDDSGNLLSPAPMDWDMLMEPPFLFTAVPPSGELAPPAVPPQAPRCHVVIRGLCGEQP
Immunogen PRKPSLGAILDGPSPEPGQQLGQGLDDSGNLLSPAPMDWDMLMEPPFLFTAVPPSGELAPPAVPPQAPRCHVVIRGLCGEQP
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names DKFZp761K032, LOC90113
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q8N398
HTS Code 3002150000
Gene ID 90113
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-VWA5B2 Antibody 100ul

Anti-VWA5B2 Antibody 100ul