BPHL,Bph-rp,MCNAA
  • BPHL,Bph-rp,MCNAA

Anti-BPHL Antibody 25ul

Ref: AN-HPA036752-25ul
Anti-BPHL

Información del producto

Polyclonal Antibody against Human BPHL, Gene description: biphenyl hydrolase-like (serine hydrolase), Alternative Gene Names: Bph-rp, MCNAA, Validated applications: ICC, IHC, WB, Uniprot ID: Q86WA6, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name BPHL
Gene Description biphenyl hydrolase-like (serine hydrolase)
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications WB, ICC, IHC
Sequence SVTSAKVAVNGVQLHYQQTGEGDHAVLLLPGMLGSGETDFGPQLKNLNKKLFTVVAWDPRGYGHSRPPDRDFPADF
Immunogen SVTSAKVAVNGVQLHYQQTGEGDHAVLLLPGMLGSGETDFGPQLKNLNKKLFTVVAWDPRGYGHSRPPDRDFPADF
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names Bph-rp, MCNAA
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q86WA6
HTS Code 3002150000
Gene ID 670
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-BPHL Antibody 25ul

Anti-BPHL Antibody 25ul