SCN11A,NaN,Nav1.9
  • SCN11A,NaN,Nav1.9

Anti-SCN11A Antibody 100ul

Ref: AN-HPA036746-100ul
Anti-SCN11A

Información del producto

Polyclonal Antibody against Human SCN11A, Gene description: sodium channel, voltage-gated, type XI, alpha subunit, Alternative Gene Names: NaN, Nav1.9, SCN12A, SNS-2, Validated applications: IHC, Uniprot ID: Q9UI33, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name SCN11A
Gene Description sodium channel, voltage-gated, type XI, alpha subunit
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC
Sequence EERNGNLEGEARKTKVQLALDRFRRAFCFVRHTLEHFCHKWCRKQNLPQQKEVAGGCAAQSKDIIPLVME
Immunogen EERNGNLEGEARKTKVQLALDRFRRAFCFVRHTLEHFCHKWCRKQNLPQQKEVAGGCAAQSKDIIPLVME
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names NaN, Nav1.9, SCN12A, SNS-2
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q9UI33
HTS Code 3002150000
Gene ID 11280
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-SCN11A Antibody 100ul

Anti-SCN11A Antibody 100ul