VWA3B,DKFZp686F2227
  • VWA3B,DKFZp686F2227

Anti-VWA3B Antibody 25ul

Ref: AN-HPA036700-25ul
Anti-VWA3B

Información del producto

Polyclonal Antibody against Human VWA3B, Gene description: von Willebrand factor A domain containing 3B, Alternative Gene Names: DKFZp686F2227, MGC26733, Validated applications: IHC, Uniprot ID: Q502W6, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name VWA3B
Gene Description von Willebrand factor A domain containing 3B
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC
Sequence LTGGEFHFYNFGCKDPTPPEAVQNEDLTLLVKEMEQGHSDLEKMQDLYSESLIMDWWYNAEKDGDSKHQKEICSMISTPEKCAKP
Immunogen LTGGEFHFYNFGCKDPTPPEAVQNEDLTLLVKEMEQGHSDLEKMQDLYSESLIMDWWYNAEKDGDSKHQKEICSMISTPEKCAKP
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names DKFZp686F2227, MGC26733
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q502W6
HTS Code 3002150000
Gene ID 200403
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-VWA3B Antibody 25ul

Anti-VWA3B Antibody 25ul