TNKS2,PARP-5b
  • TNKS2,PARP-5b

Anti-TNKS2 Antibody 100ul

Ref: AN-HPA036606-100ul
Anti-TNKS2

Información del producto

Polyclonal Antibody against Human TNKS2, Gene description: tankyrase, TRF1-interacting ankyrin-related ADP-ribose polymerase 2, Alternative Gene Names: PARP-5b, PARP-5c, PARP5B, PARP5C, pART6, TANK2, TNKL, Validated applications: ICC, Uniprot ID: Q9H2K2, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name TNKS2
Gene Description tankyrase, TRF1-interacting ankyrin-related ADP-ribose polymerase 2
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC
Sequence SLDNLSGSFSELSSVVSSSGTEGASSLEKKEVPGVDFSITQFVRNLGLEH
Immunogen SLDNLSGSFSELSSVVSSSGTEGASSLEKKEVPGVDFSITQFVRNLGLEH
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names PARP-5b, PARP-5c, PARP5B, PARP5C, pART6, TANK2, TNKL
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q9H2K2
HTS Code 3002150000
Gene ID 80351
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-TNKS2 Antibody 100ul

Anti-TNKS2 Antibody 100ul