DPCD,DKFZP566F084
  • DPCD,DKFZP566F084

Anti-DPCD Antibody 100ul

Ref: AN-HPA036603-100ul
Anti-DPCD

Información del producto

Polyclonal Antibody against Human DPCD, Gene description: deleted in primary ciliary dyskinesia homolog (mouse), Alternative Gene Names: DKFZP566F084, RP11-529I10.4, Validated applications: ICC, IHC, Uniprot ID: Q9BVM2, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name DPCD
Gene Description deleted in primary ciliary dyskinesia homolog (mouse)
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC, IHC
Sequence YYKKFSIPDLDRHQLPLDDALLSFAHANCTLIISYQKPKEVVVAESELQKELKKVKTAHSNDGDCK
Immunogen YYKKFSIPDLDRHQLPLDDALLSFAHANCTLIISYQKPKEVVVAESELQKELKKVKTAHSNDGDCK
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names DKFZP566F084, RP11-529I10.4
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q9BVM2
HTS Code 3002150000
Gene ID 25911
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-DPCD Antibody 100ul

Anti-DPCD Antibody 100ul