DDX21,GURDB,RH-II/GU
  • DDX21,GURDB,RH-II/GU

Anti-DDX21 Antibody 100ul

Ref: AN-HPA036593-100ul
Anti-DDX21

Información del producto

Polyclonal Antibody against Human DDX21, Gene description: DEAD (Asp-Glu-Ala-Asp) box helicase 21, Alternative Gene Names: GURDB, RH-II/GU, Validated applications: ICC, IHC, WB, Uniprot ID: Q9NR30, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name DDX21
Gene Description DEAD (Asp-Glu-Ala-Asp) box helicase 21
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC, IHC, WB
Sequence DSRRWQLSVATEQPELEGPREGYGGFRGQREGSRGFRGQRDGNRRFRGQREGSRGPRGQRSGGGNKSNRSQNKGQKRSFSKAFGQ
Immunogen DSRRWQLSVATEQPELEGPREGYGGFRGQREGSRGFRGQRDGNRRFRGQREGSRGPRGQRSGGGNKSNRSQNKGQKRSFSKAFGQ
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names GURDB, RH-II/GU
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q9NR30
HTS Code 3002150000
Gene ID 9188
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-DDX21 Antibody 100ul

Anti-DDX21 Antibody 100ul