CFAP58,bA554P13.1
  • CFAP58,bA554P13.1

Anti-CFAP58 Antibody 25ul

Ref: AN-HPA036555-25ul
Anti-CFAP58

Información del producto

Polyclonal Antibody against Human CFAP58, Gene description: cilia and flagella associated protein 58, Alternative Gene Names: bA554P13.1, C10orf80, CCDC147, FLJ35908, Validated applications: IHC, Uniprot ID: Q5T655, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name CFAP58
Gene Description cilia and flagella associated protein 58
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC
Sequence EKGGKQVLEESAFEEMERDFQGVLHELSGDKSLEKFRIEYERLHAVMKKSYDNEKRLMAKCRELNAEIVVNSAKVATALKLSQDDQTTIASLKKE
Immunogen EKGGKQVLEESAFEEMERDFQGVLHELSGDKSLEKFRIEYERLHAVMKKSYDNEKRLMAKCRELNAEIVVNSAKVATALKLSQDDQTTIASLKKE
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names bA554P13.1, C10orf80, CCDC147, FLJ35908
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q5T655
HTS Code 3002150000
Gene ID 159686
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-CFAP58 Antibody 25ul

Anti-CFAP58 Antibody 25ul