WAC,BM-016,FLJ31290
  • WAC,BM-016,FLJ31290

Anti-WAC Antibody 25ul

Ref: AN-HPA036528-25ul
Anti-WAC

Información del producto

Polyclonal Antibody against Human WAC, Gene description: WW domain containing adaptor with coiled-coil, Alternative Gene Names: BM-016, FLJ31290, MGC10753, PRO1741, Wwp4, Validated applications: IHC, Uniprot ID: Q9BTA9, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name WAC
Gene Description WW domain containing adaptor with coiled-coil
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC
Sequence RLSDGCHDRRGDSQPYQALKYSSKSHPSSGDHRHEKMRDAGDPSPPNKMLRRSDSPENKYSDSTGHSKAKNVHTHRVRERDGGTSYSPQENSH
Immunogen RLSDGCHDRRGDSQPYQALKYSSKSHPSSGDHRHEKMRDAGDPSPPNKMLRRSDSPENKYSDSTGHSKAKNVHTHRVRERDGGTSYSPQENSH
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names BM-016, FLJ31290, MGC10753, PRO1741, Wwp4
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q9BTA9
HTS Code 3002150000
Gene ID 51322
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-WAC Antibody 25ul

Anti-WAC Antibody 25ul