DHRS9,3alpha-HSD
  • DHRS9,3alpha-HSD

Anti-DHRS9 Antibody 25ul

Ref: AN-HPA036491-25ul
Anti-DHRS9

Información del producto

Polyclonal Antibody against Human DHRS9, Gene description: dehydrogenase/reductase (SDR family) member 9, Alternative Gene Names: 3alpha-HSD, RDH15, RDHL, RETSDR8, SDR9C4, Validated applications: IHC, WB, Uniprot ID: Q9BPW9, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name DHRS9
Gene Description dehydrogenase/reductase (SDR family) member 9
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC, WB
Sequence LRRDMKAFGVHVSCIEPGLFKTNLADPVKVIEKKLAIWEQLSPDIKQQYGEGYIEKSLDKLKGN
Immunogen LRRDMKAFGVHVSCIEPGLFKTNLADPVKVIEKKLAIWEQLSPDIKQQYGEGYIEKSLDKLKGN
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names 3alpha-HSD, RDH15, RDHL, RETSDR8, SDR9C4
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q9BPW9
HTS Code 3002150000
Gene ID 10170
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-DHRS9 Antibody 25ul

Anti-DHRS9 Antibody 25ul