YTHDC1,KIAA1966
  • YTHDC1,KIAA1966

Anti-YTHDC1 Antibody 100ul

Ref: AN-HPA036462-100ul
Anti-YTHDC1

Información del producto

Polyclonal Antibody against Human YTHDC1, Gene description: YTH domain containing 1, Alternative Gene Names: KIAA1966, YT521, YT521-B, Validated applications: ICC, IHC, Uniprot ID: Q96MU7, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name YTHDC1
Gene Description YTH domain containing 1
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC, ICC
Sequence LVSKPLSSSVSNNKRIVSTKGKSATEYKNEEYQRSERNKRLDADRKIRLSSSASREPYKNQPEKTCVRKRDPERRAKSPTPDGSERIGLEVD
Immunogen LVSKPLSSSVSNNKRIVSTKGKSATEYKNEEYQRSERNKRLDADRKIRLSSSASREPYKNQPEKTCVRKRDPERRAKSPTPDGSERIGLEVD
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names KIAA1966, YT521, YT521-B
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q96MU7
HTS Code 3002150000
Gene ID 91746
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-YTHDC1 Antibody 100ul

Anti-YTHDC1 Antibody 100ul