STT3B,FLJ90106,SIMP
  • STT3B,FLJ90106,SIMP

Anti-STT3B Antibody 100ul

Ref: AN-HPA036448-100ul
Anti-STT3B

Información del producto

Polyclonal Antibody against Human STT3B, Gene description: STT3B, subunit of the oligosaccharyltransferase complex (catalytic), Alternative Gene Names: FLJ90106, SIMP, STT3-B, Validated applications: IHC, Uniprot ID: Q8TCJ2, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name STT3B
Gene Description STT3B, subunit of the oligosaccharyltransferase complex (catalytic)
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC
Sequence KAPDNRETLDHKPRVTNIFPKQKYLSKKTTKRKRGYIK
Immunogen KAPDNRETLDHKPRVTNIFPKQKYLSKKTTKRKRGYIK
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names FLJ90106, SIMP, STT3-B
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q8TCJ2
HTS Code 3002150000
Gene ID 201595
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-STT3B Antibody 100ul

Anti-STT3B Antibody 100ul