FBXL17
  • FBXL17

Anti-FBXL17 Antibody 25ul

Ref: AN-HPA036411-25ul
Anti-FBXL17

Información del producto

Polyclonal Antibody against Human FBXL17, Gene description: F-box and leucine-rich repeat protein 17, Alternative Gene Names: DKFZP434C1715, Fbl17, Fbx13, FBXO13, Validated applications: IHC, Uniprot ID: Q9UF56, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name FBXL17
Gene Description F-box and leucine-rich repeat protein 17
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC
Sequence CLKLQRIYMQENKLVTDQSVKAFAEHCPELQYVGFMGCSVTSKGVIHLTKLRNLSSLDLRHITELDNETVME
Immunogen CLKLQRIYMQENKLVTDQSVKAFAEHCPELQYVGFMGCSVTSKGVIHLTKLRNLSSLDLRHITELDNETVME
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names DKFZP434C1715, Fbl17, Fbx13, FBXO13
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q9UF56
HTS Code 3002150000
Gene ID 64839
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-FBXL17 Antibody 25ul

Anti-FBXL17 Antibody 25ul