TTC26,dyf-13,DYF13
  • TTC26,dyf-13,DYF13

Anti-TTC26 Antibody 100ul

Ref: AN-HPA036338-100ul
Anti-TTC26

Información del producto

Polyclonal Antibody against Human TTC26, Gene description: tetratricopeptide repeat domain 26, Alternative Gene Names: dyf-13, DYF13, FLJ12571, Validated applications: IHC, Uniprot ID: A0AVF1, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name TTC26
Gene Description tetratricopeptide repeat domain 26
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC
Sequence GVQHTDKRKKKGRKIPKLEELLSKRDFTGAITLLEFKRHVGEEEEDTNLWIGYCAFHLGDYKRALEEYENATKEENCNSEVWVNLACTYFFLGMYKQAEAAGFKASKSRLQNRLLFHLAH
Immunogen GVQHTDKRKKKGRKIPKLEELLSKRDFTGAITLLEFKRHVGEEEEDTNLWIGYCAFHLGDYKRALEEYENATKEENCNSEVWVNLACTYFFLGMYKQAEAAGFKASKSRLQNRLLFHLAH
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names dyf-13, DYF13, FLJ12571
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID A0AVF1
HTS Code 3002150000
Gene ID 79989
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-TTC26 Antibody 100ul

Anti-TTC26 Antibody 100ul