NIF3L1,ALS2CR1 Ver mas grande

Anti-NIF3L1 Antibody 100ul

AN-HPA036335-100ul

Producto nuevo

Anti-NIF3L1

Más detalles

Por favor regístrese para ver el precio

Comprando este producto generará 5 Biopuntos. Su cesta contiene un total 5 Biopuntos puede ser convertido en un Biobonos Descuento 20.00EUR.


Añadir a Mis Favoritos

Hoja técnica

Size 100ul
Gene Name NIF3L1
Gene Description NIF3 NGG1 interacting factor 3-like 1 (S. cerevisiae)
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications WB, IHC
Sequence LLSSLNDFASLSFAESWDNVGLLVEPSPPHTVNTLFLTNDLTEEVMEEVLQKKADLILSYHPPIFRPMKRITWNTWKERLVIRALE
Immunogen LLSSLNDFASLSFAESWDNVGLLVEPSPPHTVNTLFLTNDLTEEVMEEVLQKKADLILSYHPPIFRPMKRITWNTWKERLVIRALE
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names ALS2CR1, CALS-7, MDS015
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q9GZT8
HTS Code 3002150000
Gene ID 60491
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Aplicación WB, IHC
Conjugation Unconjugated

Más información

Polyclonal Antibody against Human NIF3L1, Gene description: NIF3 NGG1 interacting factor 3-like 1 (S. cerevisiae), Alternative Gene Names: ALS2CR1, CALS-7, MDS015, Validated applications: IHC, WB, Uniprot ID: Q9GZT8, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image