IGSF3,EWI-3
  • IGSF3,EWI-3

Anti-IGSF3 Antibody 100ul

Ref: AN-HPA036305-100ul
Anti-IGSF3

Información del producto

Polyclonal Antibody against Human IGSF3, Gene description: immunoglobulin superfamily, member 3, Alternative Gene Names: EWI-3, MGC117164, V8, Validated applications: IHC, WB, Uniprot ID: O75054, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name IGSF3
Gene Description immunoglobulin superfamily, member 3
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC, WB
Sequence VGTVEFHDLVTFTRDGGVQWGDRSSSFRTRTAIEKAESSNNVRLSISRASDTEAGKYQCVAELWRKNYNNTWTRLAERTSNLLEIRVLQPVTKLQVSKSKRTLTLVENKPIQLNCSVKSQTSQNSHFAVLWYVHKPSDA
Immunogen VGTVEFHDLVTFTRDGGVQWGDRSSSFRTRTAIEKAESSNNVRLSISRASDTEAGKYQCVAELWRKNYNNTWTRLAERTSNLLEIRVLQPVTKLQVSKSKRTLTLVENKPIQLNCSVKSQTSQNSHFAVLWYVHKPSDA
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names EWI-3, MGC117164, V8
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID O75054
HTS Code 3002150000
Gene ID 3321
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-IGSF3 Antibody 100ul

Anti-IGSF3 Antibody 100ul