SENP8,DEN1,HsT17512
  • SENP8,DEN1,HsT17512

Anti-SENP8 Antibody 100ul

Ref: AN-HPA036273-100ul
Anti-SENP8

Información del producto

Polyclonal Antibody against Human SENP8, Gene description: SUMO/sentrin specific peptidase family member 8, Alternative Gene Names: DEN1, HsT17512, NEDP1, PRSC2, Validated applications: ICC, IHC, WB, Uniprot ID: Q96LD8, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name SENP8
Gene Description SUMO/sentrin specific peptidase family member 8
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC, IHC, WB
Sequence RKGDKLAFVEEKAPAQQNSYDCGMYVICNTEALCQNFFRQQTESLLQLLTPAYITKKRGEWKDLITTLAK
Immunogen RKGDKLAFVEEKAPAQQNSYDCGMYVICNTEALCQNFFRQQTESLLQLLTPAYITKKRGEWKDLITTLAK
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names DEN1, HsT17512, NEDP1, PRSC2
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q96LD8
HTS Code 3002150000
Gene ID 123228
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-SENP8 Antibody 100ul

Anti-SENP8 Antibody 100ul