APOL3,APOLIII,CG12-1
  • APOL3,APOLIII,CG12-1

Anti-APOL3 Antibody 100ul

Ref: AN-HPA036228-100ul
Anti-APOL3

Información del producto

Polyclonal Antibody against Human APOL3, Gene description: apolipoprotein L, 3, Alternative Gene Names: APOLIII, CG12-1, Validated applications: ICC, Uniprot ID: O95236, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name APOL3
Gene Description apolipoprotein L, 3
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC
Sequence TFTFPFGFQGISQRLENVSGYYADARLEVGSTQLRTAGSCSHSFKRSFLEKKRFTEEATKYFRERVSPVHLQILL
Immunogen TFTFPFGFQGISQRLENVSGYYADARLEVGSTQLRTAGSCSHSFKRSFLEKKRFTEEATKYFRERVSPVHLQILL
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names APOLIII, CG12-1
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID O95236
HTS Code 3002150000
Gene ID 80833
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-APOL3 Antibody 100ul

Anti-APOL3 Antibody 100ul