SLC7A7,LPI,y+LAT-1
  • SLC7A7,LPI,y+LAT-1

Anti-SLC7A7 Antibody 25ul

Ref: AN-HPA036227-25ul
Anti-SLC7A7

Información del producto

Polyclonal Antibody against Human SLC7A7, Gene description: solute carrier family 7 (amino acid transporter light chain, y+L system), member 7, Alternative Gene Names: LPI, y+LAT-1, Validated applications: IHC, WB, Uniprot ID: Q9UM01, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name SLC7A7
Gene Description solute carrier family 7 (amino acid transporter light chain, y+L system), member 7
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications WB, IHC
Sequence DSTEYEVASQPEVETSPLGDGASPGPEQVKLKK
Immunogen DSTEYEVASQPEVETSPLGDGASPGPEQVKLKK
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names LPI, y+LAT-1
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q9UM01
HTS Code 3002150000
Gene ID 9056
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-SLC7A7 Antibody 25ul

Anti-SLC7A7 Antibody 25ul