NCF4,p40phox,SH3PXD4
  • NCF4,p40phox,SH3PXD4

Anti-NCF4 Antibody 100ul

Ref: AN-HPA036156-100ul
Anti-NCF4

Información del producto

Polyclonal Antibody against Human NCF4, Gene description: neutrophil cytosolic factor 4, 40kDa, Alternative Gene Names: p40phox, SH3PXD4, Validated applications: IHC, Uniprot ID: Q15080, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name NCF4
Gene Description neutrophil cytosolic factor 4, 40kDa
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC
Sequence MAVAQQLRAESDFEQLPDDVAISANIADIEEKRGFTSHFVFVIEVKTKGGSKYLIYRRY
Immunogen MAVAQQLRAESDFEQLPDDVAISANIADIEEKRGFTSHFVFVIEVKTKGGSKYLIYRRY
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names p40phox, SH3PXD4
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q15080
HTS Code 3002150000
Gene ID 4689
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-NCF4 Antibody 100ul

Anti-NCF4 Antibody 100ul