ASCL4,bHLHa44,HASH4
  • ASCL4,bHLHa44,HASH4

Anti-ASCL4 Antibody 100ul

Ref: AN-HPA036116-100ul
Anti-ASCL4

Información del producto

Polyclonal Antibody against Human ASCL4, Gene description: achaete-scute family bHLH transcription factor 4, Alternative Gene Names: bHLHa44, HASH4, Validated applications: IHC, Uniprot ID: Q6XD76, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name ASCL4
Gene Description achaete-scute family bHLH transcription factor 4
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC
Sequence METRKPAERLALPYSLRTAPLGVPGTLPGLPRRDPLRVALRLDAACWEWARSGCARGWQYLPVPLDSAFEPAF
Immunogen METRKPAERLALPYSLRTAPLGVPGTLPGLPRRDPLRVALRLDAACWEWARSGCARGWQYLPVPLDSAFEPAF
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names bHLHa44, HASH4
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q6XD76
HTS Code 3002150000
Gene ID 121549
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-ASCL4 Antibody 100ul

Anti-ASCL4 Antibody 100ul