BDH2,DHRS6,FLJ13261
  • BDH2,DHRS6,FLJ13261

Anti-BDH2 Antibody 100ul

Ref: AN-HPA036028-100ul
Anti-BDH2

Información del producto

Polyclonal Antibody against Human BDH2, Gene description: 3-hydroxybutyrate dehydrogenase, type 2, Alternative Gene Names: DHRS6, FLJ13261, PRO20933, SDR15C1, UCPA-OR, UNQ6308, Validated applications: IHC, Uniprot ID: Q9BUT1, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name BDH2
Gene Description 3-hydroxybutyrate dehydrogenase, type 2
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC
Sequence CPGTVDTPSLQERIQARGNPEEARNDFLKRQKTGRFATAEEIAMLCVYLASDESAYVTGNPVIIDGGWSL
Immunogen CPGTVDTPSLQERIQARGNPEEARNDFLKRQKTGRFATAEEIAMLCVYLASDESAYVTGNPVIIDGGWSL
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names DHRS6, FLJ13261, PRO20933, SDR15C1, UCPA-OR, UNQ6308
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q9BUT1
HTS Code 3002150000
Gene ID 56898
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-BDH2 Antibody 100ul

Anti-BDH2 Antibody 100ul