REPIN1,AP4
  • REPIN1,AP4

Anti-REPIN1 Antibody 100ul

Ref: AN-HPA036022-100ul
Anti-REPIN1

Información del producto

Polyclonal Antibody against Human REPIN1, Gene description: replication initiator 1, Alternative Gene Names: AP4, H_DJ0584D14.12, RIP60, Zfp464, ZNF464, Validated applications: ICC, IHC, WB, Uniprot ID: Q9BWE0, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name REPIN1
Gene Description replication initiator 1
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications WB, IHC, ICC
Sequence MLERRCRGPLAMGLAQPRLLSGPSQESPQTLGKESRGLRQQGTSVAQSGAQAPGRAHRCAHCRRHFPGWVALWLHTRRCQARLPLPCPE
Immunogen MLERRCRGPLAMGLAQPRLLSGPSQESPQTLGKESRGLRQQGTSVAQSGAQAPGRAHRCAHCRRHFPGWVALWLHTRRCQARLPLPCPE
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names AP4, H_DJ0584D14.12, RIP60, Zfp464, ZNF464
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q9BWE0
HTS Code 3002150000
Gene ID 29803
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-REPIN1 Antibody 100ul

Anti-REPIN1 Antibody 100ul