PARK2,AR-JP,parkin
  • PARK2,AR-JP,parkin

Anti-PARK2 Antibody 100ul

Ref: AN-HPA036012-100ul
Anti-PARK2

Información del producto

Polyclonal Antibody against Human PARK2, Gene description: parkin RBR E3 ubiquitin protein ligase, Alternative Gene Names: AR-JP, parkin, PDJ, Validated applications: ICC, IHC, Uniprot ID: O60260, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name PARK2
Gene Description parkin RBR E3 ubiquitin protein ligase
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC, IHC
Sequence LHHFRILGEEQYNRYQQYGAEECVLQMGGVLCPRPGCGAGLLPEPDQRKVTCEGGNGLGCGFAFCRECKEAYHEGECS
Immunogen LHHFRILGEEQYNRYQQYGAEECVLQMGGVLCPRPGCGAGLLPEPDQRKVTCEGGNGLGCGFAFCRECKEAYHEGECS
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names AR-JP, parkin, PDJ
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID O60260
HTS Code 3002150000
Gene ID 5071
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-PARK2 Antibody 100ul

Anti-PARK2 Antibody 100ul