ZFYVE16,KIAA0305
  • ZFYVE16,KIAA0305

Anti-ZFYVE16 Antibody 100ul

Ref: AN-HPA035936-100ul
Anti-ZFYVE16

Información del producto

Polyclonal Antibody against Human ZFYVE16, Gene description: zinc finger, FYVE domain containing 16, Alternative Gene Names: KIAA0305, PPP1R69, Validated applications: ICC, IHC, Uniprot ID: Q7Z3T8, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name ZFYVE16
Gene Description zinc finger, FYVE domain containing 16
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC, IHC
Sequence TGNEGLPTSGSFTLDDDVFAETEEPSSPTGVLVNSNLPIASISDYRLLCDINKYVCNKISLLPNDEDSLPPLLVASGEKGS
Immunogen TGNEGLPTSGSFTLDDDVFAETEEPSSPTGVLVNSNLPIASISDYRLLCDINKYVCNKISLLPNDEDSLPPLLVASGEKGS
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names KIAA0305, PPP1R69
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q7Z3T8
HTS Code 3002150000
Gene ID 9765
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-ZFYVE16 Antibody 100ul

Anti-ZFYVE16 Antibody 100ul