DCUN1D1,DCUN1L1
  • DCUN1D1,DCUN1L1

Anti-DCUN1D1 Antibody 100ul

Ref: AN-HPA035911-100ul
Anti-DCUN1D1

Información del producto

Polyclonal Antibody against Human DCUN1D1, Gene description: DCN1, defective in cullin neddylation 1, domain containing 1, Alternative Gene Names: DCUN1L1, RP42, SCCRO, SCRO, Tes3, Validated applications: ICC, IHC, WB, Uniprot ID: Q96GG9, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name DCUN1D1
Gene Description DCN1, defective in cullin neddylation 1, domain containing 1
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC, IHC, WB
Sequence RQFMIFTQSSEKTAVSCLSQNDWKLDVATDNFFQNPELYIRESVKGSLDRKKLEQLYNR
Immunogen RQFMIFTQSSEKTAVSCLSQNDWKLDVATDNFFQNPELYIRESVKGSLDRKKLEQLYNR
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names DCUN1L1, RP42, SCCRO, SCRO, Tes3
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q96GG9
HTS Code 3002150000
Gene ID 54165
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-DCUN1D1 Antibody 100ul

Anti-DCUN1D1 Antibody 100ul