PALLD,CGI-151
  • PALLD,CGI-151

Anti-PALLD Antibody 100ul

Ref: AN-HPA035905-100ul
Anti-PALLD

Información del producto

Polyclonal Antibody against Human PALLD, Gene description: palladin, cytoskeletal associated protein, Alternative Gene Names: CGI-151, KIAA0992, SIH002, Validated applications: ICC, WB, Uniprot ID: Q8WX93, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name PALLD
Gene Description palladin, cytoskeletal associated protein
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications WB, ICC
Sequence NCSYESMGESNNDHFQHFPPPPPILETSSLELASKKPSEIQQVNNPELGLSRAALQMQFNAAERETNGVHPSRGVNGLINGKANSNKSLPTP
Immunogen NCSYESMGESNNDHFQHFPPPPPILETSSLELASKKPSEIQQVNNPELGLSRAALQMQFNAAERETNGVHPSRGVNGLINGKANSNKSLPTP
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names CGI-151, KIAA0992, SIH002
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q8WX93
HTS Code 3002150000
Gene ID 23022
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-PALLD Antibody 100ul

Anti-PALLD Antibody 100ul