SEC31B,DKFZP434M183
  • SEC31B,DKFZP434M183

Anti-SEC31B Antibody 100ul

Ref: AN-HPA035882-100ul
Anti-SEC31B

Información del producto

Polyclonal Antibody against Human SEC31B, Gene description: SEC31 homolog B (S. cerevisiae), Alternative Gene Names: DKFZP434M183, SEC31B-1, SEC31L2, Validated applications: IHC, Uniprot ID: Q9NQW1, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name SEC31B
Gene Description SEC31 homolog B (S. cerevisiae)
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC
Sequence HAQGSAVLGQQSPPFPFPRIVVGATLHSKETSSYRLGSQPSHQVPTPSPRPRVFTPQSSPAMPLAPSHPSPYQGPRTQNISDYRA
Immunogen HAQGSAVLGQQSPPFPFPRIVVGATLHSKETSSYRLGSQPSHQVPTPSPRPRVFTPQSSPAMPLAPSHPSPYQGPRTQNISDYRA
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names DKFZP434M183, SEC31B-1, SEC31L2
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q9NQW1
HTS Code 3002150000
Gene ID 25956
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-SEC31B Antibody 100ul

Anti-SEC31B Antibody 100ul