RBP2,CRABP-II,CRBP2
  • RBP2,CRABP-II,CRBP2

Anti-RBP2 Antibody 100ul

Ref: AN-HPA035866-100ul
Anti-RBP2

Información del producto

Polyclonal Antibody against Human RBP2, Gene description: retinol binding protein 2, cellular, Alternative Gene Names: CRABP-II, CRBP2, CRBPII, RBPC2, Validated applications: ICC, IHC, WB, Uniprot ID: P50120, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name RBP2
Gene Description retinol binding protein 2, cellular
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications WB, IHC, ICC
Sequence RKIAVRLTQTKVIDQDGDNFKTKTTSTFRNYDVDFTVGVEFDEYTKSLDNRHVKALVTWEGDVLVC
Immunogen RKIAVRLTQTKVIDQDGDNFKTKTTSTFRNYDVDFTVGVEFDEYTKSLDNRHVKALVTWEGDVLVC
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names CRABP-II, CRBP2, CRBPII, RBPC2
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID P50120
HTS Code 3002150000
Gene ID 5948
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-RBP2 Antibody 100ul

Anti-RBP2 Antibody 100ul