PPP2R3A,PPP2R3
  • PPP2R3A,PPP2R3

Anti-PPP2R3A Antibody 100ul

Ref: AN-HPA035830-100ul
Anti-PPP2R3A

Información del producto

Polyclonal Antibody against Human PPP2R3A, Gene description: protein phosphatase 2, regulatory subunit B'', alpha, Alternative Gene Names: PPP2R3, Validated applications: IHC, Uniprot ID: Q06190, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name PPP2R3A
Gene Description protein phosphatase 2, regulatory subunit B'', alpha
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC
Sequence FEQAIHYCTGTCHTFTHGIDCIVVHHSVCADLLHIPVSQFKDADLNSMFLPHENGLSSAEGDYPQQAFTGIPRVKRGSTFQNTYNLKDIAGEAISFASG
Immunogen FEQAIHYCTGTCHTFTHGIDCIVVHHSVCADLLHIPVSQFKDADLNSMFLPHENGLSSAEGDYPQQAFTGIPRVKRGSTFQNTYNLKDIAGEAISFASG
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names PPP2R3
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q06190
HTS Code 3002150000
Gene ID 5523
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-PPP2R3A Antibody 100ul

Anti-PPP2R3A Antibody 100ul