MRPS36,DC47,MRP-S36
  • MRPS36,DC47,MRP-S36

Anti-MRPS36 Antibody 25ul

Ref: AN-HPA035802-25ul
Anti-MRPS36

Información del producto

Polyclonal Antibody against Human MRPS36, Gene description: mitochondrial ribosomal protein S36, Alternative Gene Names: DC47, MRP-S36, Validated applications: ICC, IHC, WB, Uniprot ID: P82909, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name MRPS36
Gene Description mitochondrial ribosomal protein S36
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC, ICC, WB
Sequence SSVISQHSKGSKSPDLLMYQGPPDTAEIIKTLPQKYRRKLVSQEEMEFIQRGGPE
Immunogen SSVISQHSKGSKSPDLLMYQGPPDTAEIIKTLPQKYRRKLVSQEEMEFIQRGGPE
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names DC47, MRP-S36
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID P82909
HTS Code 3002150000
Gene ID 92259
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-MRPS36 Antibody 25ul

Anti-MRPS36 Antibody 25ul