DIS3L2,FAM6A
  • DIS3L2,FAM6A

Anti-DIS3L2 Antibody 25ul

Ref: AN-HPA035796-25ul
Anti-DIS3L2

Información del producto

Polyclonal Antibody against Human DIS3L2, Gene description: DIS3 like 3'-5' exoribonuclease 2, Alternative Gene Names: FAM6A, FLJ36974, MGC42174, Validated applications: IHC, WB, Uniprot ID: Q8IYB7, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name DIS3L2
Gene Description DIS3 like 3'-5' exoribonuclease 2
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC, WB
Sequence RNRALNGDLVVVKLLPEEHWKVVKPESNDKETEAAYESDIPEELCGHHLPQQSLKSYNDSPDVIVEAQFDGSDSEDGHGITQNVLVDGVKKLS
Immunogen RNRALNGDLVVVKLLPEEHWKVVKPESNDKETEAAYESDIPEELCGHHLPQQSLKSYNDSPDVIVEAQFDGSDSEDGHGITQNVLVDGVKKLS
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names FAM6A, FLJ36974, MGC42174
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q8IYB7
HTS Code 3002150000
Gene ID 129563
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-DIS3L2 Antibody 25ul

Anti-DIS3L2 Antibody 25ul