MYOZ2,C4orf5,CS-1
  • MYOZ2,C4orf5,CS-1

Anti-MYOZ2 Antibody 25ul

Ref: AN-HPA035764-25ul
Anti-MYOZ2

Información del producto

Polyclonal Antibody against Human MYOZ2, Gene description: myozenin 2, Alternative Gene Names: C4orf5, CS-1, Validated applications: ICC, IHC, Uniprot ID: Q9NPC6, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name MYOZ2
Gene Description myozenin 2
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC, ICC
Sequence LEELSHLSNRGARLFKMRQRRSDKYTFENFQYQSRAQINHSIAMQNGKVDGSNLEGGSQQAPLTPPNTPDPR
Immunogen LEELSHLSNRGARLFKMRQRRSDKYTFENFQYQSRAQINHSIAMQNGKVDGSNLEGGSQQAPLTPPNTPDPR
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names C4orf5, CS-1
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q9NPC6
HTS Code 3002150000
Gene ID 51778
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-MYOZ2 Antibody 25ul

Anti-MYOZ2 Antibody 25ul