SERINC1,KIAA1253
  • SERINC1,KIAA1253

Anti-SERINC1 Antibody 100ul

Ref: AN-HPA035738-100ul
Anti-SERINC1

Información del producto

Polyclonal Antibody against Human SERINC1, Gene description: serine incorporator 1, Alternative Gene Names: KIAA1253, TDE1L, TDE2, TMS-2, Validated applications: ICC, IHC, Uniprot ID: Q9NRX5, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name SERINC1
Gene Description serine incorporator 1
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC, IHC
Sequence TNEPETNCNPSLLSIIGYNTTSTVPKEGQSVQ
Immunogen TNEPETNCNPSLLSIIGYNTTSTVPKEGQSVQ
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names KIAA1253, TDE1L, TDE2, TMS-2
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q9NRX5
HTS Code 3002150000
Gene ID 57515
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-SERINC1 Antibody 100ul

Anti-SERINC1 Antibody 100ul