TPRKB,CGI-121
  • TPRKB,CGI-121

Anti-TPRKB Antibody 25ul

Ref: AN-HPA035712-25ul
Anti-TPRKB

Información del producto

Polyclonal Antibody against Human TPRKB, Gene description: TP53RK binding protein, Alternative Gene Names: CGI-121, Validated applications: ICC, IHC, Uniprot ID: Q9Y3C4, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name TPRKB
Gene Description TP53RK binding protein
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC, IHC
Sequence MQLTHQLDLFPECRVTLLLFKDVKNAGDLRRKAMEGTIDGSLINPTVIVDPFQILVAANKAVHLYKLGKMKTRTLSTEII
Immunogen MQLTHQLDLFPECRVTLLLFKDVKNAGDLRRKAMEGTIDGSLINPTVIVDPFQILVAANKAVHLYKLGKMKTRTLSTEII
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names CGI-121
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q9Y3C4
HTS Code 3002150000
Gene ID 51002
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-TPRKB Antibody 25ul

Anti-TPRKB Antibody 25ul