RPP40,bA428J1.3
  • RPP40,bA428J1.3

Anti-RPP40 Antibody 25ul

Ref: AN-HPA035686-25ul
Anti-RPP40

Información del producto

Polyclonal Antibody against Human RPP40, Gene description: ribonuclease P/MRP 40kDa subunit, Alternative Gene Names: bA428J1.3, RNASEP1, Validated applications: ICC, IHC, WB, Uniprot ID: O75818, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name RPP40
Gene Description ribonuclease P/MRP 40kDa subunit
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC, IHC, WB
Sequence RALELFDWLGAVFSNVDLNNEPNNFISTYCCPEPSTVVAKAYLCTITGFILPEKICLLLEHLCHYFDEPKLAPWVTLSVQ
Immunogen RALELFDWLGAVFSNVDLNNEPNNFISTYCCPEPSTVVAKAYLCTITGFILPEKICLLLEHLCHYFDEPKLAPWVTLSVQ
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names bA428J1.3, RNASEP1
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID O75818
HTS Code 3002150000
Gene ID 10799
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-RPP40 Antibody 25ul

Anti-RPP40 Antibody 25ul