EDF1,EDF-1
  • EDF1,EDF-1

Anti-EDF1 Antibody 100ul

Ref: AN-HPA035642-100ul
Anti-EDF1

Información del producto

Polyclonal Antibody against Human EDF1, Gene description: endothelial differentiation-related factor 1, Alternative Gene Names: EDF-1, Validated applications: ICC, IHC, WB, Uniprot ID: O60869, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name EDF1
Gene Description endothelial differentiation-related factor 1
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications WB, IHC, ICC
Sequence KLDRETEELHHDRVTLEVGKVIQQGRQSKGLTQKDLATKINEKPQVIADYESGRAIPNNQVLGKIERAIGLKLRGKDIGKPIE
Immunogen KLDRETEELHHDRVTLEVGKVIQQGRQSKGLTQKDLATKINEKPQVIADYESGRAIPNNQVLGKIERAIGLKLRGKDIGKPIE
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names EDF-1
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID O60869
HTS Code 3002150000
Gene ID 8721
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-EDF1 Antibody 100ul

Anti-EDF1 Antibody 100ul