SCAF8,KIAA1116,RBM16
  • SCAF8,KIAA1116,RBM16

Anti-SCAF8 Antibody 25ul

Ref: AN-HPA035601-25ul
Anti-SCAF8

Información del producto

Polyclonal Antibody against Human SCAF8, Gene description: SR-related CTD-associated factor 8, Alternative Gene Names: KIAA1116, RBM16, Validated applications: ICC, IHC, WB, Uniprot ID: Q9UPN6, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name SCAF8
Gene Description SR-related CTD-associated factor 8
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications WB, IHC, ICC
Sequence LSMTPETVKDVGFGSLVIPGGSVASNLATSALPAGNVFNAPTKQAEPEEKVPHLIDHQISSGENTRSVIPNDISSNAAILG
Immunogen LSMTPETVKDVGFGSLVIPGGSVASNLATSALPAGNVFNAPTKQAEPEEKVPHLIDHQISSGENTRSVIPNDISSNAAILG
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names KIAA1116, RBM16
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q9UPN6
HTS Code 3002150000
Gene ID 22828
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-SCAF8 Antibody 25ul

Anti-SCAF8 Antibody 25ul