STAM2,Hbp
  • STAM2,Hbp

Anti-STAM2 Antibody 25ul

Ref: AN-HPA035529-25ul
Anti-STAM2

Información del producto

Polyclonal Antibody against Human STAM2, Gene description: signal transducing adaptor molecule (SH3 domain and ITAM motif) 2, Alternative Gene Names: Hbp, Validated applications: ICC, IHC, WB, Uniprot ID: O75886, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name STAM2
Gene Description signal transducing adaptor molecule (SH3 domain and ITAM motif) 2
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC, IHC, WB
Sequence PAQTSYLSTGQDTVSNPTYMNQNSNLQSATGTTAYTQQMGMSVDMSSYQNTTSNLPQLAGFPVTVPAHPVAQQHTNYHQQP
Immunogen PAQTSYLSTGQDTVSNPTYMNQNSNLQSATGTTAYTQQMGMSVDMSSYQNTTSNLPQLAGFPVTVPAHPVAQQHTNYHQQP
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names Hbp
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID O75886
HTS Code 3002150000
Gene ID 10254
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-STAM2 Antibody 25ul

Anti-STAM2 Antibody 25ul