EHBP1,KIAA0903
  • EHBP1,KIAA0903

Anti-EHBP1 Antibody 25ul

Ref: AN-HPA035469-25ul
Anti-EHBP1

Información del producto

Polyclonal Antibody against Human EHBP1, Gene description: EH domain binding protein 1, Alternative Gene Names: KIAA0903, NACSIN, Validated applications: ICC, IHC, WB, Uniprot ID: Q8NDI1, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name EHBP1
Gene Description EH domain binding protein 1
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human, Mouse
Applications IHC, WB, ICC
Sequence MRSAKSASSSEELINKLNFLDEAEKDLATVNSNPFDDPDAAELNPFGDPDSEEPITETASPRKTEDSFYNNSYNPFKEVQTPQYLNPFDEPEAFV
Immunogen MRSAKSASSSEELINKLNFLDEAEKDLATVNSNPFDDPDAAELNPFGDPDSEEPITETASPRKTEDSFYNNSYNPFKEVQTPQYLNPFDEPEAFV
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names KIAA0903, NACSIN
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q8NDI1
HTS Code 3002150000
Gene ID 23301
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-EHBP1 Antibody 25ul

Anti-EHBP1 Antibody 25ul