WDR92,FLJ31741,Monad
  • WDR92,FLJ31741,Monad

Anti-WDR92 Antibody 25ul

Ref: AN-HPA035335-25ul
Anti-WDR92

Información del producto

Polyclonal Antibody against Human WDR92, Gene description: WD repeat domain 92, Alternative Gene Names: FLJ31741, Monad, Validated applications: ICC, IHC, WB, Uniprot ID: Q96MX6, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name WDR92
Gene Description WD repeat domain 92
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human, Mouse
Applications IHC, ICC, WB
Sequence YNQEERVVCAGYDNGDIKLFDLRNMALRWETNIKNGVCSLEFDRKDISMNKLVATSLEGKFHVFDMRTQHPTK
Immunogen YNQEERVVCAGYDNGDIKLFDLRNMALRWETNIKNGVCSLEFDRKDISMNKLVATSLEGKFHVFDMRTQHPTK
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names FLJ31741, Monad
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q96MX6
HTS Code 3002150000
Gene ID 116143
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-WDR92 Antibody 25ul

Anti-WDR92 Antibody 25ul