SEC13,D3S1231E
  • SEC13,D3S1231E

Anti-SEC13 Antibody 100ul

Ref: AN-HPA035292-100ul
Anti-SEC13

Información del producto

Polyclonal Antibody against Human SEC13, Gene description: SEC13 homolog (S. cerevisiae), Alternative Gene Names: D3S1231E, npp-20, SEC13L1, SEC13R, Validated applications: IHC, WB, Uniprot ID: P55735, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name SEC13
Gene Description SEC13 homolog (S. cerevisiae)
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC, WB
Sequence ISLLTYTGEGQWEVKKINNAHTIGCNAVSWAPAVVPGSLIDHPSGQKPNYIKRFASGGCDNLIKLWKEEEDGQWKEEQKLEAHSDWVRDV
Immunogen ISLLTYTGEGQWEVKKINNAHTIGCNAVSWAPAVVPGSLIDHPSGQKPNYIKRFASGGCDNLIKLWKEEEDGQWKEEQKLEAHSDWVRDV
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names D3S1231E, npp-20, SEC13L1, SEC13R
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID P55735
HTS Code 3002150000
Gene ID 6396
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-SEC13 Antibody 100ul

Anti-SEC13 Antibody 100ul