RFTN2,C2orf11
  • RFTN2,C2orf11

Anti-RFTN2 Antibody 100ul

Ref: AN-HPA035232-100ul
Anti-RFTN2

Información del producto

Polyclonal Antibody against Human RFTN2, Gene description: raftlin family member 2, Alternative Gene Names: C2orf11, FLJ30574, Raftlin-2, Validated applications: IHC, WB, Uniprot ID: Q52LD8, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name RFTN2
Gene Description raftlin family member 2
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications WB, IHC
Sequence NVAAKRGMKFVGFISQHYSPSKFCNGTNHDGDIESMLHVRHGSDENCRSWNEGTLSGQSSESGIEEELHHESGQYQMEQNGSPTSSKSRKGE
Immunogen NVAAKRGMKFVGFISQHYSPSKFCNGTNHDGDIESMLHVRHGSDENCRSWNEGTLSGQSSESGIEEELHHESGQYQMEQNGSPTSSKSRKGE
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names C2orf11, FLJ30574, Raftlin-2
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q52LD8
HTS Code 3002150000
Gene ID 130132
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-RFTN2 Antibody 100ul

Anti-RFTN2 Antibody 100ul