IKZF1,hIk-1
  • IKZF1,hIk-1

Anti-IKZF1 Antibody 25ul

Ref: AN-HPA035221-25ul
Anti-IKZF1

Información del producto

Polyclonal Antibody against Human IKZF1, Gene description: IKAROS family zinc finger 1 (Ikaros), Alternative Gene Names: hIk-1, Hs.54452, IKAROS, LyF-1, PPP1R92, ZNFN1A1, Validated applications: ICC, IHC, Uniprot ID: Q13422, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name IKZF1
Gene Description IKAROS family zinc finger 1 (Ikaros)
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC, ICC
Sequence SNNEEQRSGLIYLTNHIAPHARNGLSLKEEHRAYDLLRAASENSQDALRVVSTSGEQMKVYKC
Immunogen SNNEEQRSGLIYLTNHIAPHARNGLSLKEEHRAYDLLRAASENSQDALRVVSTSGEQMKVYKC
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names hIk-1, Hs.54452, IKAROS, LyF-1, PPP1R92, ZNFN1A1
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q13422
HTS Code 3002150000
Gene ID 10320
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-IKZF1 Antibody 25ul

Anti-IKZF1 Antibody 25ul