IGF2BP2,IMP-2
  • IGF2BP2,IMP-2

Anti-IGF2BP2 Antibody 100ul

Ref: AN-HPA035145-100ul
Anti-IGF2BP2

Información del producto

Polyclonal Antibody against Human IGF2BP2, Gene description: insulin-like growth factor 2 mRNA binding protein 2, Alternative Gene Names: IMP-2, Validated applications: ICC, IHC, Uniprot ID: Q9Y6M1, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name IGF2BP2
Gene Description insulin-like growth factor 2 mRNA binding protein 2
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC, IHC
Sequence ITVKGTVEACASAEIEIMKKLREAFENDMLAVNTHSGYFSSLYPHHQFGPFPHHHSYPEQEIVNLFIPTQAV
Immunogen ITVKGTVEACASAEIEIMKKLREAFENDMLAVNTHSGYFSSLYPHHQFGPFPHHHSYPEQEIVNLFIPTQAV
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names IMP-2
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q9Y6M1
HTS Code 3002150000
Gene ID 10644
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-IGF2BP2 Antibody 100ul

Anti-IGF2BP2 Antibody 100ul