GKAP1,FKSG21,GKAP42
  • GKAP1,FKSG21,GKAP42

Anti-GKAP1 Antibody 25ul

Ref: AN-HPA035117-25ul
Anti-GKAP1

Información del producto

Polyclonal Antibody against Human GKAP1, Gene description: G kinase anchoring protein 1, Alternative Gene Names: FKSG21, GKAP42, Validated applications: IHC, Uniprot ID: Q5VSY0, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name GKAP1
Gene Description G kinase anchoring protein 1
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human, Mouse
Applications IHC
Sequence ITQWEAKYKEVKARNAQLLKMLQEGEMKDKAEILLQVDESQSIKNELTIQVTSLHAALEQERSKVKVLQAELAKYQGGRKGKRNSESDQCR
Immunogen ITQWEAKYKEVKARNAQLLKMLQEGEMKDKAEILLQVDESQSIKNELTIQVTSLHAALEQERSKVKVLQAELAKYQGGRKGKRNSESDQCR
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names FKSG21, GKAP42
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q5VSY0
HTS Code 3002150000
Gene ID 80318
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-GKAP1 Antibody 25ul

Anti-GKAP1 Antibody 25ul