GOLGA4,GCP2,GOLG
  • GOLGA4,GCP2,GOLG

Anti-GOLGA4 Antibody 25ul

Ref: AN-HPA035102-25ul
Anti-GOLGA4

Información del producto

Polyclonal Antibody against Human GOLGA4, Gene description: golgin A4, Alternative Gene Names: GCP2, GOLG, golgin-240, p230, Validated applications: ICC, IHC, Uniprot ID: Q13439, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name GOLGA4
Gene Description golgin A4
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC, IHC
Sequence NLLKEELDQQNKRFDCLKGEMEDDKSKMEKKESNLETELKSQTARIMELEDHITQKTIEIESLNEVLKNYNQQKDIEHKELVQKLQHFQELGEEKDNRVKEAE
Immunogen NLLKEELDQQNKRFDCLKGEMEDDKSKMEKKESNLETELKSQTARIMELEDHITQKTIEIESLNEVLKNYNQQKDIEHKELVQKLQHFQELGEEKDNRVKEAE
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names GCP2, GOLG, golgin-240, p230
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q13439
HTS Code 3002150000
Gene ID 2803
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-GOLGA4 Antibody 25ul

Anti-GOLGA4 Antibody 25ul