MPHOSPH10,CT90
  • MPHOSPH10,CT90

Anti-MPHOSPH10 Antibody 100ul

Ref: AN-HPA035060-100ul
Anti-MPHOSPH10

Información del producto

Polyclonal Antibody against Human MPHOSPH10, Gene description: M-phase phosphoprotein 10 (U3 small nucleolar ribonucleoprotein), Alternative Gene Names: CT90, MPP10, MPP10P, PPP1R106, Validated applications: ICC, IHC, Uniprot ID: O00566, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name MPHOSPH10
Gene Description M-phase phosphoprotein 10 (U3 small nucleolar ribonucleoprotein)
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC, ICC
Sequence DDDLQENEDNKQHKESLKRVTFALPDDAETEDTGVLNVKKNSDEVKSSFEKRQEKMNEKIASLEKELLEKKPWQLQGEVTAQKRPENSLLEETLHFDHAVR
Immunogen DDDLQENEDNKQHKESLKRVTFALPDDAETEDTGVLNVKKNSDEVKSSFEKRQEKMNEKIASLEKELLEKKPWQLQGEVTAQKRPENSLLEETLHFDHAVR
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names CT90, MPP10, MPP10P, PPP1R106
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID O00566
HTS Code 3002150000
Gene ID 10199
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-MPHOSPH10 Antibody 100ul

Anti-MPHOSPH10 Antibody 100ul